Advertisements
KALIOTOXIN
Price: | US$ 100 |
---|---|
Minimum Order: | 1mg |
Payment Terms: | T/T |
Port of Export: |
Product Details
Model No.: | Brand Name: | KS-V Peptide |
---|
Certification: | |
---|---|
Specification: | The potent blocker of voltage-sensitive K+ channels |
Packaging & Delivery
Packaging: | pe tube, transport at room temperature |
---|---|
Delivery/Lead Time: | 7-15 days |
Production Capacity: | 100g |
Product Description
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels. SPECIFICATION OF KALIOTOXIN
CAT K1070-V
CAS NO. 145199-73-1
Product Name Kaliotoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4149.89 Da
Molecular formula C171H283N55O49S6
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C.
Storage of solutions Up to two weeks at 4C or three months at -20C.
Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35)
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
SUPPLIER PROFILE
|
|||
---|---|---|---|
Company: | Hefei KS-V Peptide Biological Technology Co., Ltd. | ||
City/State | Hefei, Anhui | Country: | China |
Business Type: | Export - Manufacturer / Trading Company | Established: | 2018 |
Member Since: | 2022 | Contact Person | KSV Peptide |
SUPPLIER PROFILE
City/State/Country -
Hefei, Anhui
China
Business Type -
Export - Manufacturer / Trading Company
Established -
2018
Member Since -
2022
Contact Person -
KSV Peptide